discontinued

H00008465-Q01-10 AURKA

Search for all "AURKA"

10 µg / €380.00

Quick Overview

AURKA

H00008465-Q01-10

Product Description for AURKA

AURKA.
Presentation: Purified

Properties for AURKA

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms ARK1, AURORA2, AurA, BTAK, STK15, STK7, aurora kinase A
Presentation Purified
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQ KQLQATSVPHPVSRPLNNTQKSKQ*
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
State:
Purified
  • LinkedIn