P3793 C21orf118

Search for all "C21orf118"

0.1 mg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

C21orf118

P3793

Product Description for C21orf118

C21orf118.

Properties for C21orf118

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms BC-1514, PRED85
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information Yeast
Application SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MAERGQHRARIVASEGASCKPWQLPCGVEPASAQKSKIGVWEPLPRFQKMYGNAWMPWQKSAVGEGPSWRISARAV QKGNVGSEPQHRIPTGAPPSGAVRRGPPSSRPQNDRSTDSLLHAPGKTADNTSP
Format
Buffer System:
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol).
State:
Liquid
  • LinkedIn