discontinued

P3793 C21orf118

Search for all "C21orf118"

Quick Overview

C21orf118

P3793

Product Description for C21orf118

C21orf118.

Properties for C21orf118

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms BC-1514, PRED85
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information Yeast
Application SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MAERGQHRARIVASEGASCKPWQLPCGVEPASAQKSKIGVWEPLPRFQKMYGNAWMPWQKSAVGEGPSWRISARAV QKGNVGSEPQHRIPTGAPPSGAVRRGPPSSRPQNDRSTDSLLHAPGKTADNTSP
Format
Buffer System:
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol).
State:
Liquid
  • LinkedIn