discontinued

P5857 C22orf41

Search for all "C22orf41"

Quick Overview

C22orf41

P5857

Product Description for C22orf41

C22orf41.

Properties for C22orf41

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms -
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L190
Add. information 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLA ESMRRLEDAFVNCKEEMEKNWQELLHETKQRL
Format
State:
Liquid
  • LinkedIn