discontinued

H00619208-P01-10 C6orf225

Search for all "C6orf225"

10 µg / €380.00

Quick Overview

C6orf225

H00619208-P01-10

Product Description for C6orf225

C6orf225.

Properties for C6orf225

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms DKFZp586F0922
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4G0N7
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKE MHPK
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn