P4614 Ccl19

Search for all "Ccl19"

20 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Ccl19

P4614

Product Description for Ccl19

Ccl19.

Properties for Ccl19

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms CKb11, ELC, MIP3B, Scya19, exodus-3
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q548P0
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn