discontinued

P4614 Ccl19

Search for all "Ccl19"

Quick Overview

Ccl19

P4614

Product Description for Ccl19

Ccl19.

Properties for Ccl19

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms CKb11, ELC, MIP3B, Scya19, exodus-3
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q548P0
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn