discontinued

P4353 Ccl21a

Search for all "Ccl21a"

Quick Overview

Ccl21a

P4353

Product Description for Ccl21a

Ccl21a.

Properties for Ccl21a

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms 6CKBAC2, 6Ckine, ALP, AW987545, CKb9, MGC107632, SCYA21a, SLC, Scya21, Scya21b, Tca4, plt
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P84444
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQ SPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Format
Buffer System:
Lyophilized from PBS.
State:
Lyophilized
  • LinkedIn