P4353 Ccl21a

Search for all "Ccl21a"

20 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Ccl21a

P4353

Product Description for Ccl21a

Ccl21a.

Properties for Ccl21a

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms 6CKBAC2, 6Ckine, ALP, AW987545, CKb9, MGC107632, SCYA21a, SLC, Scya21, Scya21b, Tca4, plt
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P84444
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQ SPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Format
Buffer System:
Lyophilized from PBS.
State:
Lyophilized
  • LinkedIn