discontinued

P6150 CD178 / Fas Ligand

Search for all "CD178 / Fas Ligand"

Quick Overview

CD178 / Fas Ligand

P6150

Product Description for CD178 / Fas Ligand

CD178 / Fas Ligand.

Properties for CD178 / Fas Ligand

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms APT1LG1, APTL, Apoptosis antigen ligand, CD95L protein, FASL, FASLG, Fas antigen ligand, TNFSF6, Tumor necrosis factor ligand superfamily member 6
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P48023
Add. information Hamster
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Description
AA Sequence:
HHHHHHHHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQS CNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFG LYKL
Format
Buffer System:
Lyophilized from 0.5x PBS, pH 7.5.
State:
Lyophilized
  • LinkedIn