AR31161PU-N CD309 / VEGFR-2 / Flk-1 (esKDR)

Search for all "CD309 / VEGFR-2 / Flk-1"

20 µg / €460.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

CD309 / VEGFR-2 / Flk-1

AR31161PU-N

Product Description for CD309 / VEGFR-2 / Flk-1

CD309 / VEGFR-2 / Flk-1.
Presentation: Purified

Properties for CD309 / VEGFR-2 / Flk-1

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms FLK1, KDR, Kinase NYK, Kinase insert domain receptor, Protein-tyrosine kinase receptor Flk-1, VEGF Receptor 2, VEGFR2, Vascular endothelial growth factor receptor 2
Presentation Purified
Molecular weight ~ 105 kDa
Source Insect cells
Species (Protein) Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
CD309 / VEGFR-2 / Flk-1
Purity > 95 % by SDS-PAGE and silver stain
Background Disruption of the precise balance of positive and negative molecular regulators of blood and lymphatic vessel growth can lead to myriad diseases. Although dozens of natural inhibitors of hemangiogenesis have been identified, an endogenous selective inhibitor of lymphatic vessel growth has not to our knowledge been previously described. A splice variant of the gene encoding vascular endothelial growth factor receptor-2 (VEGFR-2) that encodes a secreted form of the protein, designated endogenous soluble VEGFR-2 (esVEGFR-2/KDR) has been described. The endogenous soluble esKDR inhibits developmental and reparative lymphangiogenesis by blocking VEGF-C function. Tissue-specific loss of esKDR in mice induced, at birth, spontaneous lymphatic invasion of the normally alymphatic cornea and hyperplasia of skin lymphatics without affecting blood vasculature. Administration of esKDR inhibited lymphangiogenesis but not hemangiogenesis induced by corneal suture injury or transplantation, enhanced corneal allograft survival and suppressed lymphangioma cellular proliferation. Naturally occurring esKDR thus acts as a molecular uncoupler of blood and lymphatic vessels; modulation of esKDR might have therapeutic effects in treating lymphatic vascular malformations, transplantation rejection and, potentially, tumor lymphangiogenesis and lymphedema.
General Readings
  1. Shibata et al, BMC Medicine 8 (2010)
  2. Albaquerque et al, Nature Med 2009
  3. Ebos et al, Mol Cancer Res 2 (2004)
  4. Ebos JM, Lee CR, Bogdanovic E, Alami J, Van Slyke P, Francia G, et al. Vascular endothelial growth factor-mediated decrease in plasma soluble vascular endothelial growth factor receptor-2 levels as a surrogate biomarker for tumor growth. Cancer Res. 2008 Jan 15;68(2):521-9. doi: 10.1158/0008-5472.CAN-07-3217. PubMed PMID: 18199548.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Mouse VEGFR-2/Flk-1 (native), soluble. 
Subunit: glycosylated monomer.
AA Sequence:
ASVGLTGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRV VGNDTGAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKR FVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLN CTARTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVTKSDQGEYTCVASSGRMIKRNRTF VRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAPDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYT VILTNPISMEKQSHMVSLVVNVPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPGQT SPYACKEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVISFHVIRGPEI TVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCKNLDALWKLNGTMFSNSTNDILIVAF QNASLQDQGDYVCSAQDKKTKKRHCLVKQLIILGMEASLGDRIAMP
Biological activity:
Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells.
Molecular weight:
(654 amino acids)
Format
Buffer System:
25 mM MES, 100 mM NaCl, pH 5.5
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg of esKDR
Purity:
>95% by SDS-PAGE and silver stain
State:
Lyophilized protein
Purified
Reconstitution:
Restore in water or PBS to a concentration of not lower than 100 μg/ml.
  • LinkedIn