discontinued

H00000985-Q01-25 CDC2L2

Search for all "CDC2L2"

25 µg / €510.00

Quick Overview

CDC2L2

H00000985-Q01-25

Product Description for CDC2L2

CDC2L2.

Properties for CDC2L2

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms CDC2L2 - cell division cycle 2-like 2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, MGC131975, PITSLRE, PITSLRE proteins, p58GTA
Source in vitro transl.
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLK ETGFHLTTTNQGASAAGPGFSLKF*
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn