P4184 CHD7

Search for all "CHD7"

20 µg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

CHD7

P4184

Product Description for CHD7

CHD7.

Properties for CHD7

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms FLJ20357, FLJ20361, IS3, KAL5, KIAA1416
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P39476
Add. information SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELL QMLEKQKK
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn