discontinued

P4184 CHD7

Search for all "CHD7"

Quick Overview

CHD7

P4184

Product Description for CHD7

CHD7.

Properties for CHD7

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms FLJ20357, FLJ20361, IS3, KAL5, KIAA1416
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P39476
Add. information SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELL QMLEKQKK
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn