P4959 coaA (Escherichia coli)

Search for all "coaA (Escherichia coli)"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

coaA (Escherichia coli)

P4959

Product Description for coaA (Escherichia coli)

coaA (Escherichia coli).

Properties for coaA (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK3966, JW3942, panK, rts, ts-9
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0A6I3
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVA EIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDG FLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVL QSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKE INWLNLKQNILPTRERASLILTKSANHAVEEVRLRK
Format
Buffer System:
In 20 mM Tris-HCl, , 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn