discontinued

H00432395-Q01-10 Complement Component C4B

Search for all "Complement Component C4B"

10 µg / €380.00

Quick Overview

Complement Component C4B

H00432395-Q01-10

Product Description for Complement Component C4B

Complement Component C4B.

Properties for Complement Component C4B

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms C4A, C4A91, C4B, C4B1, C4B12, C4B2, C4B3, C4B5, C4F, CO4, XXbac-BPG116M5.7 - complement component 4B, telomeric
Source in vitro transl.
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQL ELRPVLYNYLDKNLTVSVHVSPVE*
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn