discontinued

H00001675-Q01-25 Complement factor D

Search for all "Complement factor D"

Quick Overview

Complement factor D

H00001675-Q01-25

Product Description for Complement factor D

Complement factor D.

Properties for Complement factor D

Product Category Proteins & Growth Factors
Target Category
Quantity 25 µg
Synonyms Adipsin, C3 convertase activator, CFD, DF, PFD, Properdin factor D
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P00746
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
GIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVC GNRKKPGIYTRVASYAAWIDSVLA
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn