discontinued

P6060 Csf1

Search for all "Csf1"

Quick Overview

Csf1

P6060

Product Description for Csf1

Csf1.

Properties for Csf1

Product Category Proteins & Growth Factors
Quantity 10 µg
Species (Protein) Rat
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Description
AA Sequence:
MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANA TERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVV TKP
Format
Buffer System:
Lyophilized from 20 mM Tris (pH 9.0, 0.1 mM Calcium Chloride and 100 mM Arginine).
State:
Lyophlized
  • LinkedIn