P6060 Csf1

Search for all "Csf1"

10 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Csf1

P6060

Product Description for Csf1

Csf1.

Properties for Csf1

Product Category Proteins & Growth Factors
Quantity 10 µg
Species (Protein) Rat
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Description
AA Sequence:
MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANA TERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVV TKP
Format
Buffer System:
Lyophilized from 20 mM Tris (pH 9.0, 0.1 mM Calcium Chloride and 100 mM Arginine).
State:
Lyophlized
  • LinkedIn