discontinued

P6163 Ctf2

Search for all "Ctf2"

Quick Overview

Ctf2

P6163

Product Description for Ctf2

Ctf2.

Properties for Ctf2

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms Gm494, NP
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P83714
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. This solution can be stored at 2-8°C for up to 1 week.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Description
AA Sequence:
MAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRA QGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFER KCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Format
Buffer System:
Lyophilized from 2.5 mM Tris (pH 10.2, 0.5 mM DTT).
State:
Lyophilized
  • LinkedIn