P6163 Ctf2

Search for all "Ctf2"

25 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Ctf2

P6163

Product Description for Ctf2

Ctf2.

Properties for Ctf2

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms Gm494, NP
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P83714
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. This solution can be stored at 2-8°C for up to 1 week.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Description
AA Sequence:
MAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRA QGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFER KCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Format
Buffer System:
Lyophilized from 2.5 mM Tris (pH 10.2, 0.5 mM DTT).
State:
Lyophilized
  • LinkedIn