discontinued

P5373 Cxcl12

Search for all "Cxcl12"

25 µg / €580.00

Quick Overview

Cxcl12

P5373

Product Description for Cxcl12

Cxcl12.

Properties for Cxcl12

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms AI174028, PBSF, PBSF/SDF-1, SDF-1, Scyb12, Sdf1, Sdf1a, Sdf1b, TLSF, TLSF-a, TLSF-b, TPAR1
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
H7BX38
Add. information Bacteria
Application SDS-PAGE, Enzyme
Storage Store at -20°C on dry atmosphere..
After reconstitution with sterile water, store at -20°C or add a carrier protein (0.1% HSA or BSA) for long term storage.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Format
Buffer System:
No additives.
State:
Lyophilized
  • LinkedIn