P3794 CXorf27

Search for all "CXorf27"

0.1 mg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

CXorf27

P3794

Product Description for CXorf27

CXorf27.

Properties for CXorf27

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms 1700054O13Rik, HIP17, HYPM
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75409
Add. information Yeast
Application SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNG SMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND
Format
Buffer System:
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol).
State:
Liquid
  • LinkedIn