P5004 cysH (Escherichia coli)

Search for all "cysH (Escherichia coli)"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

cysH (Escherichia coli)

P5004

Product Description for cysH (Escherichia coli)

cysH (Escherichia coli).

Properties for cysH (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK2757, JW2732
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P17854
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGI QAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYN DINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEG YLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
Format
Buffer System:
In 20 mM Tris-HCl, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn