P4996 deoC (Escherichia coli)

Search for all "deoC (Escherichia coli)"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

deoC (Escherichia coli)

P4996

Product Description for deoC (Escherichia coli)

deoC (Escherichia coli).

Properties for deoC (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK4373, JW4344, dra, thyR, tlr
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0A6L0
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIA RKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAA NVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRT AEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (2 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn