P5968 DKK1

Search for all "DKK1"

10 µg / €450.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

DKK1

P5968

Product Description for DKK1

DKK1.

Properties for DKK1

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms DKK-1, SK
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
I1W660
Add. information Human
Application Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAG VQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKG QEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSR LHTCQRH
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn