discontinued

P5968 DKK1

Search for all "DKK1"

Quick Overview

DKK1

P5968

Product Description for DKK1

DKK1.

Properties for DKK1

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms DKK-1, SK
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
I1W660
Add. information Human
Application Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAG VQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKG QEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSR LHTCQRH
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn