discontinued

P5401 FABP12

Search for all "FABP12"

Quick Overview

FABP12

P5401

Product Description for FABP12

FABP12.

Properties for FABP12

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms -
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NFH5
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGSHMIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITI KTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRT YEKVSSNSVSNS
Format
Buffer System:
In 20 mM Tris-HCl, 0.15M NaCl, pH 7.5.
State:
Liquid
  • LinkedIn