P5401 FABP12

Search for all "FABP12"

50 µg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

FABP12

P5401

Product Description for FABP12

FABP12.

Properties for FABP12

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms -
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NFH5
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGSHMIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITI KTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRT YEKVSSNSVSNS
Format
Buffer System:
In 20 mM Tris-HCl, 0.15M NaCl, pH 7.5.
State:
Liquid
  • LinkedIn