P4835 fimC (Escherichia coli)

Search for all "fimC (Escherichia coli)"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

fimC (Escherichia coli)

P4835

Product Description for fimC (Escherichia coli)

fimC (Escherichia coli).

Properties for fimC (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK4307, JW4279
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P31697
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application Func, SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMGVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKDGRFIVTPPLF AMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAEKL RFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (1 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn