P5905 fshb/cga

Search for all "fshb/cga"

0.1 mg / €780.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

fshb/cga

P5905

Product Description for fshb/cga

fshb/cga.

Properties for fshb/cga

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms gthI
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6TCF7
Add. information NuPAGE Stained with Coomassie Blue
Human
Application SDS-PAGE
Concentration 0.98 mg/mL
Storage Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
GSWSHPQFEKGSWSHPQFEKGSWSHPQFEKGSAESECRCSCRLTNISITVESEECGSCVTIDTTACAGLCWTMDRV YPSSMAQHTQKVCNFKNLMYKSYEFKGCPAGVDSVFVYPVALSCECNQVNSDTTDWGAISPQTTSCSIHGGGSGGG SGGGSGGGYSRNDVSNYGCEECKLKMNERFSKPGAPVYQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKE SKMVATNIPLYNHTDCHCSTCYYHKS
Format
Buffer System:
In PBS without preservative.
State:
Liquid
  • LinkedIn