discontinued

P3377 Green Fluorescent with Fc

Search for all "Green Fluorescent with Fc"

0.1 mg / €580.00

Quick Overview

Green Fluorescent with Fc

P3377

Product Description for Green Fluorescent with Fc

Green Fluorescent with Fc.

Properties for Green Fluorescent with Fc

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Jellyfishes
Application SDS-PAGE
Storage Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICTTGKLPVPWPTLVTTFSYGVQCFSRYPD HMKQHDFFKSAMPEGYVQERTIFYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYI MGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILLEFVTAAR ITHGMDELYKASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Format
Buffer System:
In 100 mM glycine, 25 mM Tris-HCl, pH 7.3 (10% glycerol).
  • LinkedIn