P0002-25 GST

Search for all "GST"

25 µg / €490.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

GST

P0002-25

Product Description for GST

GST.

Properties for GST

Product Category Proteins & Growth Factors
Quantity 25 µg
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYI ADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHP DFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQG PLEDPGYRGRTSFV
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn