discontinued

P4874 HBsAg

Search for all "HBsAg"

Quick Overview

HBsAg

P4874

Product Description for HBsAg

HBsAg.

Properties for HBsAg

Product Category Proteins & Growth Factors
Quantity 50 µg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D0E5A7
Add. information Hamster
Application SDS-PAGE
Concentration 1.0 ug/uL
Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMC LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPI PSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
Format
Buffer System:
In 7.5 mM phosphate, 75 mM NaCl, pH 7.2 (50% glycerol).
State:
Liquid
  • LinkedIn