discontinued

P5118 HBsAg

Search for all "HBsAg"

Quick Overview

HBsAg

P5118

Product Description for HBsAg

HBsAg.

Properties for HBsAg

Product Category Proteins & Growth Factors
Quantity 50 µg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O90772
Add. information Yeast
Application SDS-PAGE
Concentration 50.0 ug/50 uL
Storage Store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPI PSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI(G enebankaccession#,CAA05872).
Format
Buffer System:
In 20 mM phosphate buffer, 154 mM NaCl2.
State:
Liquid
  • LinkedIn