P5118 HBsAg

Search for all "HBsAg"

50 µg / €450.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

HBsAg

P5118

Product Description for HBsAg

HBsAg.

Properties for HBsAg

Product Category Proteins & Growth Factors
Quantity 50 µg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O90772
Add. information Yeast
Application SDS-PAGE
Concentration 50.0 ug/50 uL
Storage Store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPI PSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI(G enebankaccession#,CAA05872).
Format
Buffer System:
In 20 mM phosphate buffer, 154 mM NaCl2.
State:
Liquid
  • LinkedIn