discontinued

AR10577PU-N Hepatitis C Virus NS4 a+b (1658-1863)

Search for all "Hepatitis C Virus NS4 a+b"

0.5 mg / €750.00

Quick Overview

Hepatitis C Virus NS4 a+b

AR10577PU-N

Product Description for Hepatitis C Virus NS4 a+b

Hepatitis C Virus NS4 a+b.
Presentation: Purified

Properties for Hepatitis C Virus NS4 a+b

Product Category Proteins & Growth Factors
Quantity 0.5 mg
Presentation Purified
Source E. coli
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Purity >95% pure as determined by 10% PAGE (coomassie staining).
Purification Method: HCV NS4 a+b protein was purified by proprietary chromatographic technique.
Application HCV NS4 a+b antigen is suitable for ELISA and Western blots, excellent antigen for detection of HCV with minimal specificity problems.
Background

HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae.
HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6). 

Storage

Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Description
Description:
The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863.
The protein is fused with beta-Galactosidase (114 kDa) at N-terminus, pI 5.45.
Specificity: mmunoreactive with sera of HCV-infected individuals.
AA Sequence:

(1658)STWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQ FKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTT SQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGA GVAGAL(1863)
Format
Buffer System:
20mM Tris-Hcl pH 8, 8M Urea and 10mM B-ME
Purity:
>95% pure as determined by 10% PAGE (coomassie staining).
Purification Method: HCV NS4 a+b protein was purified by proprietary chromatographic technique.
State:
Purified
  • LinkedIn