P3949 HSPB3

Search for all "HSPB3"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

HSPB3

P3949

Product Description for HSPB3

HSPB3.

Properties for HSPB3

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms HSPL27
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12988
Add. information Loading 3 ug protein in 15% SDS PAGE.
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPV DSAAETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAV LCHDGILVVEVKDPVGTK
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (5% glycerol, 1 M Urea).
State:
Liquid
  • LinkedIn