discontinued

P3949 HSPB3

Search for all "HSPB3"

Quick Overview

HSPB3

P3949

Product Description for HSPB3

HSPB3.

Properties for HSPB3

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms HSPL27
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12988
Add. information Loading 3 ug protein in 15% SDS PAGE.
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPV DSAAETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAV LCHDGILVVEVKDPVGTK
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (5% glycerol, 1 M Urea).
State:
Liquid
  • LinkedIn