discontinued

P3452 IGF1

Search for all "IGF1"

Quick Overview

IGF1

P3452

Product Description for IGF1

IGF1.

Properties for IGF1

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms IGFI
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01343
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application Func, SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Format
Buffer System:
In PBS, pH 7.4.
State:
Liquid
  • LinkedIn