P3452 IGF1

Search for all "IGF1"

0.1 mg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

IGF1

P3452

Product Description for IGF1

IGF1.

Properties for IGF1

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms IGFI
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01343
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application Func, SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Format
Buffer System:
In PBS, pH 7.4.
State:
Liquid
  • LinkedIn