discontinued

P3625 IGF1

Search for all "IGF1"

Quick Overview

IGF1

P3625

Product Description for IGF1

IGF1.

Properties for IGF1

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms IGFI
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01343
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
TFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAK SA
Format
Buffer System:
Lyophilized from PBS, pH 7.4.
State:
Lyophilized
  • LinkedIn