P4624 Il25

Search for all "Il25"

25 µg / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Il25

P4624

Product Description for Il25

Il25.

Properties for Il25

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms IL-17E, Il17e
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8VHH8
Add. information 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNR VPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTRRYCLERRLYRVSLACVCVRPRVMA
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn