discontinued

P4624 Il25

Search for all "Il25"

Quick Overview

Il25

P4624

Product Description for Il25

Il25.

Properties for Il25

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms IL-17E, Il17e
Species (Protein) Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8VHH8
Add. information 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNR VPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTRRYCLERRLYRVSLACVCVRPRVMA
Format
Buffer System:
No additive.
State:
Lyophilized
  • LinkedIn