discontinued

P3477 IL4

Search for all "IL4"

Quick Overview

IL4

P3477

Product Description for IL4

IL4.

Properties for IL4

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms BCGF-1, BCGF1, BSF1, IL-4, MGC79402
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D4HNR6
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application Func, SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQF YSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (10% glycerol).
State:
Liquid
  • LinkedIn