P3477 IL4

Search for all "IL4"

50 µg / €640.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

IL4

P3477

Product Description for IL4

IL4.

Properties for IL4

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms BCGF-1, BCGF1, BSF1, IL-4, MGC79402
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D4HNR6
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application Func, SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQF YSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (10% glycerol).
State:
Liquid
  • LinkedIn