discontinued

P5009 Intein (Bacillus)

Search for all "Intein (Bacillus)"

Quick Overview

Intein (Bacillus)

P5009

Product Description for Intein (Bacillus)

Intein (Bacillus).

Properties for Intein (Bacillus)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MKIEEGKLVIGSLEGCFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKS DSSREVPELLKFTCNATHELVVRTPRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPE RANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDHFFDYMQKSKFHLTIEGPKVLAYLLG LWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRGASTNPGVSAWQVNTAY TAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQGGHGGIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLST DNIGTRETFLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVTKHKISYAIYM SGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYGITLSDDSDHQFLLGSQVVVQNLEHHHHH H
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn