DA3558 Interleukin-1 beta / IL-1B

Search for all "Interleukin-1 beta / IL-1B"

10 µg / €230.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Interleukin-1 beta / IL-1B

DA3558

More Views

  • DA3558

Product Description for Interleukin-1 beta / IL-1B

Interleukin-1 beta / IL-1B.
Presentation: Purified

Properties for Interleukin-1 beta / IL-1B

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms Catabolin, IL-1 beta, IL1 beta, IL1B, IL1F2
Presentation Purified
Molecular weight 17.0 kDa
Source E. coli
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P01584
Purity > 98 % pure by SDS-PAGE and Silver stain
Add. information Range: 0.1-10.0 ng/ml
Background Interleukin-1 beta (IL-1beta) is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL1F1) and IL1 beta (IL1F2), which are the products of distinct genes. IL- 1alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta converting enzyme (Caspase1/ICE) to generate the active cytokine. The mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67% 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta.
General Readings
  1. Allan SM, Tyrrell PJ, Rothwell NJ. Interleukin-1 and neuronal injury. Nat Rev Immunol. 2005 Aug;5(8):629-40. PubMed PMID: 16034365.
  2. Boraschi D, Tagliabue A. The interleukin-1 receptor family. Vitam Horm. 2006;74:229-54. PubMed PMID: 17027517.
  3. Kornman, K.S. (2006) Am. J. Clin. Nutr. 83:475S.
  4. Isoda K, Ohsuzu F. The effect of interleukin-1 receptor antagonist on arteries and cholesterol metabolism. J Atheroscler Thromb. 2006 Feb;13(1):21-30. PubMed PMID: 16505588.
  5. March CJ, Mosley B, Larsen A, Cerretti DP, Braedt G, Price V, et al. Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs. Nature. 1985 Jun 20-26;315(6021):641-7. PubMed PMID: 2989698.
  6. Auron PE, Webb AC, Rosenwasser LJ, Mucci SF, Rich A, Wolff SM, et al. Nucleotide sequence of human monocyte interleukin 1 precursor cDNA. Proc Natl Acad Sci U S A. 1984 Dec;81(24):7907-11. PubMed PMID: 6083565. (Free PMC Article available)
  7. Martinon F, Tschopp J. Inflammatory caspases and inflammasomes: master switches of inflammation. Cell Death Differ. 2007 Jan;14(1):10-22. Epub 2006 Sep 15. PubMed PMID: 16977329.
Storage Store lyophilized at RT for 3 weeks or (preferably in a desiccator) at -20°C for longer.
Following reconstitution store the antibody undiluted at 2-8°C for one week
or (in aliquots) at -20°C for longer.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA)
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Interleukin-1beta produced in E.Coli is a non-glycosylated, Interleukin-1 beta Polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa. 
Result by N-terminal sequencing: APVRSL and MAPVRS
AA Sequence:
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDD KPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQANMPVFLGGTKGGQDITDFTMQFVSS
Biological activity:
Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml.
Molecular weight:
(153 amino acids)
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg (IEU/µg) of rh IL-1beta
Purity:
>98% pure by SDS-PAGE and Silver stain
State:
Lyophilized purified protein
Purified
Reconstitution:
The lyophilized rh IL-1beta is soluble in water and most aqueous buffers.
The lyophilized powder can be restored in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  • LinkedIn