discontinued

P3626 Interleukin-1 beta / IL-1B

Search for all "Interleukin-1 beta / IL-1B"

Quick Overview

Interleukin-1 beta / IL-1B

P3626

Product Description for Interleukin-1 beta / IL-1B

Interleukin-1 beta / IL-1B.

Properties for Interleukin-1 beta / IL-1B

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms Catabolin, IL-1 beta, IL1 beta, IL1B, IL1F2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01584
Add. information Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDD KPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVS S
Format
Buffer System:
Lyophilized from PBS, pH 7.0.
State:
Lyophilized
  • LinkedIn