discontinued

P4403 Interleukin-1 beta / IL-1B

Search for all "Interleukin-1 beta / IL-1B"

Quick Overview

Interleukin-1 beta / IL-1B

P4403

Product Description for Interleukin-1 beta / IL-1B

Interleukin-1 beta / IL-1B.

Properties for Interleukin-1 beta / IL-1B

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms Catabolin, IL-1 beta, IL1 beta, IL1B, IL1F2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01584
Add. information 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Escherichia coli
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDD KPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVS S
Format
Buffer System:
Lyophilized from 10 mM Na2PO4, pH 7.5.
State:
Lyophilized
  • LinkedIn