discontinued

P3629 Interleukin-12 beta / IL12B

Search for all "Interleukin-12 beta / IL12B"

Quick Overview

Interleukin-12 beta / IL12B

P3629

Product Description for Interleukin-12 beta / IL12B

Interleukin-12 beta / IL12B.

Properties for Interleukin-12 beta / IL12B

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL-12 subunit p40, IL-12B, Interleukin-12B, NK cell stimulatory factor chain 2, NKSF2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P29460
Add. information Hamster
Application Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLS HSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAAT LSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSR QVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVP CSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESC LNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Format
Buffer System:
Lyophilized from PBS, pH 7.5.
State:
Lyophilized
  • LinkedIn