discontinued

P5393 Interleukin-12 beta / IL12B

Search for all "Interleukin-12 beta / IL12B"

Quick Overview

Interleukin-12 beta / IL12B

P5393

Product Description for Interleukin-12 beta / IL12B

Interleukin-12 beta / IL12B.

Properties for Interleukin-12 beta / IL12B

Product Category Proteins & Growth Factors
Target Category
Quantity 50 µg
Synonyms CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL-12 subunit p40, IL-12B, Interleukin-12B, NK cell stimulatory factor chain 2, NKSF2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P29460
Add. information Loading 3 ug protein in 15% SDS-PAGE
Insect
Application SDS-PAGE
Concentration 0.25 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
ADPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGE VLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCG AATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLK NSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWA SVPCSHHHHHH
Format
Buffer System:
In 20 mM Tris-HCl, 100mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol, 0.1 mM PMSF).
State:
Liquid
  • LinkedIn