discontinued

P5378 Interleukin-6 / IL6

Search for all "Interleukin-6 / IL6"

Quick Overview

Interleukin-6 / IL6

P5378

Product Description for Interleukin-6 / IL6

Interleukin-6 / IL6.

Properties for Interleukin-6 / IL6

Product Category Proteins & Growth Factors
Target Category
Quantity 10 µg
Synonyms B-cell stimulatory factor 2, BSF-2, CDF, CTL differentiation factor, Hybridoma growth factor, IFNB2, IL-6, Interferon beta-2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P05231
Add. information 0.3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue
Plants
Application WB-Re, Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water containing 0.1% HSA or BSA to a concentration of 50 ng/ul, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Result of activity analysis
Description
AA Sequence:
HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKM AEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTT NASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Format
Buffer System:
Lyophilized from 10 mM Phosphate Potasium buffer, 50 mM NaCl, pH 7. 4.
State:
Lyophilized
  • LinkedIn