discontinued

P3429 KAAG1

Search for all "KAAG1"

Quick Overview

KAAG1

P3429

Product Description for KAAG1

KAAG1.

Properties for KAAG1

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms MGC78738, RU2AS
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBP8
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPL SQRPHRTQGAGSPPETNEKLTNPQVKEK
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol).
State:
Liquid
  • LinkedIn