P3776 KAAG1

Search for all "KAAG1"

0.1 mg / €330.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

KAAG1

P3776

Product Description for KAAG1

KAAG1.

Properties for KAAG1

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms MGC78738, RU2AS
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBP8
Add. information Yeast
Application SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKL TNPQVKEK
Format
Buffer System:
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol).
State:
Liquid
  • LinkedIn