discontinued

P3776 KAAG1

Search for all "KAAG1"

Quick Overview

KAAG1

P3776

Product Description for KAAG1

KAAG1.

Properties for KAAG1

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms MGC78738, RU2AS
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBP8
Add. information Yeast
Application SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKL TNPQVKEK
Format
Buffer System:
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol).
State:
Liquid
  • LinkedIn