discontinued

H00005650-P01 KLK7 / Kallikrein-7

Search for all "KLK7 / Kallikrein-7"

Quick Overview

KLK7 / Kallikrein-7

H00005650-P01

Product Description for KLK7 / Kallikrein-7

KLK7 / Kallikrein-7.

Properties for KLK7 / Kallikrein-7

Product Category Proteins & Growth Factors
Target Category
Quantity 2 µg
Synonyms PRSS6, SCCE, Serine protease 6, Stratum corneum chymotryptic enzyme, hK7
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P49862
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEY TVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTT TSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQ PNDPGVYTQVCKFTKWINDTMKKHR
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn