discontinued

H00116842-P01 LEAP2

Search for all "LEAP2"

2 µg / €300.00

Quick Overview

LEAP2

H00116842-P01

Product Description for LEAP2

LEAP2.

Properties for LEAP2

Product Category Proteins & Growth Factors
Quantity 2 µg
Synonyms LEAP-2
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969E1
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQ E
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn