discontinued

H00440332-Q01-10 LOC440332

Search for all "LOC440332"

10 µg / €380.00

Quick Overview

LOC440332

H00440332-Q01-10

Product Description for LOC440332

LOC440332.

Properties for LOC440332

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms similar to 3-phosphoinositide dependent protein kinase-1
Source in vitro transl.
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN*
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn