P4995 Luciferase

Search for all "Luciferase"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Luciferase

P4995

Product Description for Luciferase

Luciferase.

Properties for Luciferase

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A3KBZ5
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMMEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVDITYAE YFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKK GLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKG VALPHRTACVRFSHARDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQ SALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKP GAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIV DRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKK LRGGVVFVDEVPKGLTGKLDARKIREILIKAKKGGKIAV
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (1 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn