discontinued

P4998 map (Escherichia coli)

Search for all "map (Escherichia coli)"

Quick Overview

map (Escherichia coli)

P4998

Product Description for map (Escherichia coli)

map (Escherichia coli).

Properties for map (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK0166, JW0163, pepM
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0AE18
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAV SACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQES LYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVN AGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (2 mM DTT, 10% glycerol).
State:
Liquid
  • LinkedIn