discontinued

P4999 msrB (Escherichia coli)

Search for all "msrB (Escherichia coli)"

Quick Overview

msrB (Escherichia coli)

P4999

Product Description for msrB (Escherichia coli)

msrB (Escherichia coli).

Properties for msrB (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms ECK1776, JW1767, yeaA
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0A746
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHS QTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDGENG EEING
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM DTT).
State:
Liquid
  • LinkedIn