discontinued

P4911 NS3

Search for all "NS3"

Quick Overview

NS3

P4911

Product Description for NS3

NS3.

Properties for NS3

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms -
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
B8Y460
Add. information 15% SDS-PAGE Stained with Coomassie Blue
Escherichia coli
Application SDS-PAGE
Concentration 1.0 mg/mL
Storage Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGF GAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAG ARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVA YYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNT
Format
Buffer System:
In 20 mM Tris-HCl, pH 8.0 (10% glycerol, 1 mM DTT).
State:
Liquid
  • LinkedIn