discontinued

P5005 nth (Escherichia coli)

Search for all "nth (Escherichia coli)"

Quick Overview

nth (Escherichia coli)

P5005

Product Description for nth (Escherichia coli)

nth (Escherichia coli).

Properties for nth (Escherichia coli)

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms ECK1629, JW1625
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P0AB83
Add. information Loading 3 ug protein in 15% SDS-PAGE
Escherichia coli
Application SDS-PAGE
Concentration 0.5 mg/mL
Storage Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Description
AA Sequence:
MGSSHHHHHHSSGLVPRGSHMNKAKRLEILTRLRENNPHPTTELNFSSPFELLIAVLLSAQATDVSVNKATAKLYP VANTPAAMLELGVEGVKTYIKTIGLYNSKAENIIKTCRILLEQHNGEVPEDRAALEALPGVGRKTANVVLNTAFGW PTIAVDTHIFRVCNRTQFAPGKNVEQVEEKLLKVVPAEFKVDCHHWLILHGRYTCIARKPRCGSCIIEDLCEYKEK VDI
Format
Buffer System:
In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (40% glycerol, 1 mM DTT, 0.1 mM PMSF).
State:
Liquid
  • LinkedIn